PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29719.m000316
Common NameLOC8274908, RCOM_0665590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family NF-YB
Protein Properties Length: 220aa    MW: 24193.8 Da    PI: 7.5947
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29719.m000316genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1819.9e-5722117297
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                    +eqdrflPianvsrimkk lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plkvyl+kyre+egek
  29719.m000316  22 KEQDRFLPIANVSRIMKKSLPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKVYLNKYRETEGEK 117
                    79********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.4E-5519136IPR009072Histone-fold
SuperFamilySSF471133.26E-4124130IPR009072Histone-fold
PfamPF008081.9E-272791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.3E-205573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.3E-207492No hitNo description
PRINTSPR006158.3E-2093111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MAGKRNQSSP IGSPSSGNIS DKEQDRFLPI ANVSRIMKKS LPANAKISKE AKETVQECVS  60
EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFENYV GPLKVYLNKY RETEGEKNSM  120
ARHDEQSPPP TTEINKLNDS SLPTDHHHVE VQGFNCTTGF YSLGSQVTNK SYGDNYTRSV  180
GYGENLVSGA GGFNFNKIRG NGDGNGNRAV AAQLHHGVEW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B3e-4822112292Transcription factor HapC (Eurofung)
4g91_B3e-4822112292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002528664.11e-166PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233104e-65NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLB9SRP51e-166B9SRP5_RICCO; Ccaat-binding transcription factor subunit A, putative
STRINGPOPTR_0005s08510.11e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-63nuclear factor Y, subunit B3